PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29807.m000482
Common NameLOC8276206, RCOM_0826140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 536aa    MW: 58616.7 Da    PI: 5.1731
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29807.m000482genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS424.68.2e-1301485141374
           GRAS   1 lvelLlecAeavssgdlelaqalLarlsel..aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                    lv+lL++cAe ++ gdl+la +l++ ++ l  + ++ + + ++a +f  AL+ r+++ v+++  a+ +s+       e+ + ++ f+e++P+lkf+
  29807.m000482 148 LVHLLMTCAESIQRGDLSLAGSLVEDMQALltRVNTNSGIGKVAGCFIDALSLRIFSPVNGVGVAVGASAY------ENEFLYHHFYEACPYLKFA 237
                    68***************************9766667789******************88888866655555......46678899*********** PP

           GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                    h+taNqaIlea++g+++vH++Df++++GlQWpaL+qaLa Rp+gpp lR+Tg+g+p+++ +++l+e+g +La++A++++v+f f+ ++a+rled++
  29807.m000482 238 HFTANQAILEAFDGHDCVHVVDFNLMHGLQWPALIQALALRPGGPPLLRLTGIGPPSPDGRDSLREIGVKLAELARSVNVRFAFRGVAASRLEDVK 333
                    ************************************************************************************************ PP

           GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                    +++L+v+p+Ea+aVn+++qlh+ll ++ + +  +d vL+ +++l+Pk+++vveqea+hn++ Fl+rf+eal+yys++fdsl a    + + +++v 
  29807.m000482 334 PWMLQVNPKEAIAVNSIMQLHKLLGSDPNRNLSIDMVLNWIRNLNPKIMTVVEQEANHNQPGFLDRFTEALYYYSTMFDSLGAC---ALQPEKVVA 426
                    ************************99999999*************************************************887...358888999 PP

           GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    +++++rei+nvv+ceg++r erhe l+kW++rl++aGF p++l+++a kqa++ll  ++s+gy vee++g+l+lgW++rpL+++SaW+
  29807.m000482 427 EMYIQREICNVVSCEGSARLERHEPLAKWKSRLTAAGFMPLHLGSNAFKQASMLLTLFSSEGYCVEENDGCLTLGWHSRPLIAASAWQ 514
                    999************************************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120415.9E-323097IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011292.9E-1930103No hitNo description
PROSITE profilePS5098562.587122494IPR005202Transcription factor GRAS
PfamPF035142.8E-127148514IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MVLYESSDSS TSNPLSSSSS SITNKPPEID NLLAGAGYKV RSSDLRHVAQ RLERLETAML  60
NSPSSHLSVL ASDTVLYNPS DLSSWVDSLL TEFNQSQPLP SLPPDLSDLI VPNPTVDNNS  120
WNLEHQNLSP QNQLRVVTAT EEDSAIRLVH LLMTCAESIQ RGDLSLAGSL VEDMQALLTR  180
VNTNSGIGKV AGCFIDALSL RIFSPVNGVG VAVGASAYEN EFLYHHFYEA CPYLKFAHFT  240
ANQAILEAFD GHDCVHVVDF NLMHGLQWPA LIQALALRPG GPPLLRLTGI GPPSPDGRDS  300
LREIGVKLAE LARSVNVRFA FRGVAASRLE DVKPWMLQVN PKEAIAVNSI MQLHKLLGSD  360
PNRNLSIDMV LNWIRNLNPK IMTVVEQEAN HNQPGFLDRF TEALYYYSTM FDSLGACALQ  420
PEKVVAEMYI QREICNVVSC EGSARLERHE PLAKWKSRLT AAGFMPLHLG SNAFKQASML  480
LTLFSSEGYC VEENDGCLTL GWHSRPLIAA SAWQAVPDIG SPLGIISGNI NDGVGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-531485144375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002529354.10.0PREDICTED: DELLA protein SLN1
SwissprotQ9LQT81e-162GAI_ARATH; DELLA protein GAI
TrEMBLB9STN50.0B9STN5_RICCO; DELLA protein GAI1, putative
STRINGVIT_11s0016g04630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-141GRAS family protein